DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and eve

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster


Alignment Length:246 Identity:60/246 - (24%)
Similarity:86/246 - (34%) Gaps:84/246 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 SQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRA 372
            |:|:...::...||.|||||.:||..||:||:.:.|:|...|.::|..|.|.|..:|:||||||.
  Fly    59 SRGSEIPADPSVRRYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNRRM 123

  Fly   373 KWKR----------------------VKAGLTSHGLGRNGTTSGTKIVVPIPVHVNRFAVRSQHQ 415
            |.||                      ::|...|.|:             |.|.:....|..:...
  Fly   124 KDKRQRIAVAWPYAAVYSDPAFAASILQAAANSVGM-------------PYPPYAPAAAAAAAAA 175

  Fly   416 ---QLEKMCLSGPKPDLRKKLSAEAIGGFEKFSG------------------------------- 446
               ....|..:|..|....::....:.|....:|                               
  Fly   176 AAVATNPMMATGMPPMGMPQMPTMQMPGHSGHAGHPSPYGQYRYTPYHIPARPAPPHPAGPHMHH 240

  Fly   447 ------STNASSPSGGPVGLGVG--------VGVGVGVGLGVSTPLSLARS 483
                  |...||.|.|..|| :|        .|:||||....:.||.|..|
  Fly   241 PHMMGSSATGSSYSAGAAGL-LGALPSATCYTGLGVGVPKTQTPPLDLQSS 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 25/50 (50%)
eveNP_523670.2 Homeobox 74..126 CDD:278475 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.