DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and cad

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster


Alignment Length:364 Identity:84/364 - (23%)
Similarity:124/364 - (34%) Gaps:111/364 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 HPAAQQPQAQAQPQP----PPPH--PPTH---------------ALEKQLPPTLPHPLDTRFLPF 160
            |.||....|.|..||    |..|  ||.|               |...|:.....|       .|
  Fly    15 HSAANLAYASAAGQPWNWTPNYHHTPPNHQFLGDVDSSHAAHHAAAAHQMYYNSHH-------MF 72

  Fly   161 NPAAAGVA------------------PTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHED 207
            :.|||..|                  ||...     :||.|.:.|    ||.....:|:......
  Fly    73 HSAAAASAGEWHSPASSTADNFVQNVPTSAH-----QLMQQHHHH----HAHASSSSASSGSSSS 128

  Fly   208 QANPGMAQLQEP------------------------TPPQAHSSPAKSGSHSPMEPALDVGMDED 248
            ...||..||.|.                        :.|..|......|..||  |....|.:..
  Fly   129 GGAPGAPQLNETNSSIGVGGAGGGGGVGGATDGGPGSAPPNHQQHIAEGLPSP--PITVSGSEIS 191

  Fly   249 FECSGDSCSD--------ISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDE------------- 292
            ...:..|.|.        :|...:..|.|...:.|.:....|:::...|::.             
  Fly   192 SPGAPTSASSPHHHLAHHLSAVANNNNNNNNNNNSPSTHNNNNNNNSVSNNNRTSPSKPPYFDWM 256

  Fly   293 -----GAQSRHEGGGMGGKDSQGNGSSSNSKSRRR---RTAFTSEQLLELEREFHAKKYLSLTER 349
                 .||.:.:.......:...:...::.|:|.:   |..:|..|.||||:|:...:|:::..:
  Fly   257 KKPAYPAQPQPDLSSSPNLEDLSDLLDASGKTRTKDKYRVVYTDFQRLELEKEYCTSRYITIRRK 321

  Fly   350 SQIATSLKLSEVQVKIWFQNRRAK-WKRVKAGLTSHGLG 387
            |::|.:|.|||.|||||||||||| .|:.|.|...:.:|
  Fly   322 SELAQTLSLSERQVKIWFQNRRAKERKQNKKGSDPNVMG 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 26/51 (51%)
cadNP_001260641.1 Homeobox 295..347 CDD:278475 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
43.920

Return to query results.
Submit another query.