DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and prd

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster


Alignment Length:249 Identity:59/249 - (23%)
Similarity:103/249 - (41%) Gaps:43/249 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 PHPLDTRFLPFNPAAAGVAPTDLSYRRL-------AELMNQDYVHSLSVH--------ARLQHMA 199
            |.|.:.|......||.|:.|..:| |:|       ::::|: |..:.|:.        .|:....
  Fly    43 PLPNNIRLKIVEMAADGIRPCVIS-RQLRVSHGCVSKILNR-YQETGSIRPGVIGGSKPRIATPE 105

  Fly   200 AAGRMHE-DQANPGMA--QLQEPTPPQA---HSSPAKSGSHSPMEPALDVGMDEDF-ECSGDSCS 257
            ...|:.| .:::|||.  :::|....:.   .|:.....:.|.:....|..:|.|. ..||....
  Fly   106 IENRIEEYKRSSPGMFSWEIREKLIREGVCDRSTAPSVSAISRLVRGRDAPLDNDMSSASGSPAG 170

  Fly   258 DISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRR 322
            |.:...|....:.......||..::.|..||..:.|...:.                   |.||.
  Fly   171 DGTKASSSCGSDVSGGHHNNGKPSDEDISDCESEPGIALKR-------------------KQRRC 216

  Fly   323 RTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR 376
            ||.|::.||.||||.|...:|..:..|.::|....|:|.::::||.||||:.::
  Fly   217 RTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQVWFSNRRARLRK 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 20/50 (40%)
prdNP_723721.1 PAX 27..154 CDD:238076 22/112 (20%)
Homeobox 217..269 CDD:278475 21/51 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I2937
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.