DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and UNCX

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001073930.1 Gene:UNCX / 340260 HGNCID:33194 Length:531 Species:Homo sapiens


Alignment Length:357 Identity:93/357 - (26%)
Similarity:120/357 - (33%) Gaps:119/357 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 LPHPLDTRFLPFNPAAAGVA--PTDLSYRRLAELMNQDYVHSLSVHARLQHMAAA--------GR 203
            |.||    ...|..:..||.  |..|.:.         :|:.|:.| :||..|||        |.
Human     7 LEHP----HAQFGGSLGGVVGFPYPLGHH---------HVYELAGH-QLQSAAAAASVPFSIDGL 57

  Fly   204 MHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMD-EDFECSGDSCSDISLTMSPRN 267
            :....|  ..|.:..|||    ..||..|          ||.| :.|:.| ||            
Human    58 LGGSCA--AAASVVNPTP----LLPAACG----------VGGDGQPFKLS-DS------------ 93

  Fly   268 YNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLL 332
              |:.||         :|..|                             |.||.||.||..||.
Human    94 --GDPDK---------ESPGC-----------------------------KRRRTRTNFTGWQLE 118

  Fly   333 ELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGLGRNGTTSGTKI 397
            |||:.|:...|..:..|..:|..|.|.|.:|::|||||||||:  |...|..|.||....|....
Human   119 ELEKAFNESHYPDVFMREALALRLDLVESRVQVWFQNRRAKWR--KKENTKKGPGRPAHNSHPTT 181

  Fly   398 VVPIPVHVNRFAVRSQHQQLEKMCLSGPKPDLRKKL------SAEAIGGFEKFSGSTNASSPSGG 456
            ....|:.....|    .::||||  ...|....|||      ...:.||....|..::.|...||
Human   182 CSGEPMDPEEIA----RKELEKM--EKKKRKHEKKLLKSQGRHLHSPGGLSLHSAPSSDSDSGGG 240

  Fly   457 -----------PVGLGVGVGVGVGVGLGVSTP 477
                       |...|.|.......|...:.|
Human   241 GLSPEPPEPPPPAAKGPGAHASGAAGTAPAPP 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 24/50 (48%)
UNCXNP_001073930.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..107 10/72 (14%)
Homeobox 108..161 CDD:306543 25/52 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..312 27/120 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..344
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 401..531
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.