Sequence 1: | NP_477146.1 | Gene: | unpg / 35942 | FlyBaseID: | FBgn0015561 | Length: | 485 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_878314.1 | Gene: | VSX2 / 338917 | HGNCID: | 1975 | Length: | 361 | Species: | Homo sapiens |
Alignment Length: | 253 | Identity: | 66/253 - (26%) |
---|---|---|---|
Similarity: | 98/253 - (38%) | Gaps: | 70/253 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 221 PPQAHSSPAKSG--------SHSPMEPA----------------------LDVGMDEDFECSGDS 255
Fly 256 CSDISLTMSP-RNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKS 319
Fly 320 RRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKW-KRVKAGLTS 383
Fly 384 HGLGRNGTTSG-TKIVVPIPVHVNRFA-----------VRSQHQQ-LEKMCLSGPKPD 428 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
unpg | NP_477146.1 | Homeobox | 324..375 | CDD:278475 | 24/51 (47%) |
VSX2 | NP_878314.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..28 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 104..151 | 13/60 (22%) | |||
Homeobox | 153..205 | CDD:395001 | 24/51 (47%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 262..300 | 4/10 (40%) | |||
OAR | 300..318 | CDD:397759 | |||
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 | 304..317 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 313..361 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |