DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and H2.0

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster


Alignment Length:401 Identity:97/401 - (24%)
Similarity:152/401 - (37%) Gaps:101/401 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SPTTRLASKPFPKPFSIESLIANQTPATATPPSPPEERDQEQEAEQEQELSARAMVASSALGLTQ 81
            |||:..::......||::.|:.          |.|||..::..:..    |.::....|.|....
  Fly    60 SPTSATSTTKVKLSFSVDRLLG----------SEPEESHRQSSSSP----STKSCCDGSILACCS 110

  Fly    82 FPLYNPWLHGYFAQNHERLTHLIAGGCYLPSSPAGHPAAQQPQAQAQPQPPPPHPPTHA------ 140
            ||      |.:...|.|             |...||...           ||...||.:      
  Fly   111 FP------HCFSQANAE-------------SRRFGHATL-----------PPTFTPTSSHTYPFV 145

  Fly   141 -LEKQLP-PTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGR 203
             |:|..| |.:.:....|..|.. ||...|||   |..||    .:.:.....|.:.||.    :
  Fly   146 GLDKLFPGPYMDYKSVLRPTPIR-AAEHAAPT---YPTLA----TNALLRFHQHQKQQHQ----Q 198

  Fly   204 MHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNY 268
            .|..|.:|.....|...||  |:|...|...:|:.                |.:.:.||...:.:
  Fly   199 HHHHQHHPKHLHQQHKPPP--HNSTTASALLAPLH----------------SLTSLQLTQQQQRF 245

  Fly   269 NGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRR---RTAFTSEQ 330
            .|:..:........|.:...:    |.|::...|.||.:.|||.|:.::..|:|   |..|::.|
  Fly   246 LGKTPQQLLDIAPTSPAAAAA----ATSQNGAHGHGGGNGQGNASAGSNGKRKRSWSRAVFSNLQ 306

  Fly   331 LLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGL------------TS 383
            ...||.:|..:||::..:|.::|..|.|::.|||:||||||.||:..:..|            .|
  Fly   307 RKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQPSAVPES 371

  Fly   384 HGLGRNGTTSG 394
            .|:.:..|.||
  Fly   372 GGVFKTSTPSG 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 21/50 (42%)
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 22/52 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.