DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and scro

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster


Alignment Length:363 Identity:97/363 - (26%)
Similarity:132/363 - (36%) Gaps:95/363 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 AAAGVAP-----------TDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQL 216
            |||.||.           .:|..:..:.|.|.::....||...|..:..:.|..|...||     
  Fly    79 AAAAVAHHHHNLSSIHHLQNLHSQHQSTLFNSNHSTPFSVTDILSPIEESYRKLELNGNP----- 138

  Fly   217 QEPTPPQAHSSPAKSGS-----HSPMEPALDVGMDEDFECSGDSCSDISLTMSP--RNYNGEMDK 274
              |:|.:::||.:...|     .|.|.....:|               :|..||  :.|.|..|.
  Fly   139 --PSPFRSNSSSSSINSPGTLTTSTMANPYAMG---------------TLYHSPGVQTYCGPTDN 186

  Fly   275 -SRNGAYT---NSDS---EDCSDDEGAQSRHEGGGMGGKDS-QGNGSS------SNSK------- 318
             |..|.||   ||.|   ...:|...|.||.......|..| .||.|.      |:||       
  Fly   187 LSLAGHYTDMRNSASWYGSTANDPRFAISRLMSSSASGTMSHMGNMSGLAACSVSDSKPLQFPLA 251

  Fly   319 -SRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR--VKAG 380
             .|:||..||..|:.||||.|..::|||..||..:|:.:.|:..||||||||.|.|.||  .:..
  Fly   252 QRRKRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQNHRYKCKRQAKEKA 316

  Fly   381 LTSHGLGRNGTTSGTKIVVPI------PVHVNRFAVRSQHQQLEKMCLSGPKPDLRKKLSAEAIG 439
            :..........:|..::.||:      |...|..:.:||..                        
  Fly   317 MAEQNQHNQPASSPRRVAVPVLVKDGKPCSGNNSSSQSQQH------------------------ 357

  Fly   440 GFEKFSGSTNASSPSGGPVGLG-VGVGVGVGVGLGVST 476
            |....|...|..|.:.|....| |.|...|..||.:.|
  Fly   358 GTNSTSAGNNTGSANNGNANSGIVSVTANVSGGLNLIT 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 25/50 (50%)
scroNP_001015473.1 Homeobox 256..309 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.