DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Pph13

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster


Alignment Length:143 Identity:51/143 - (35%)
Similarity:70/143 - (48%) Gaps:21/143 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 KSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKW-KRVKAGL 381
            |.||.||.|.:.||.||||.|....|..:..|.::|..:.|:|.:|::||||||||| |:.|.| 
  Fly     9 KQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKIG- 72

  Fly   382 TSHGLG---RNGTTSGTKIVVPIPVHVNRFAVRSQHQQLEKMCLSGPK--PDLRKKLSAEAIGGF 441
               |||   :.|       .:.:.|..:..||..   ||:.....|..  ||...: |:.::...
  Fly    73 ---GLGGDYKEG-------ALDLDVSYDDSAVLG---QLDSALGGGGTLLPDTPPQ-SSNSLDNE 123

  Fly   442 EKFSGSTNASSPS 454
            .|.|..|.|.|||
  Fly   124 LKASYGTGAMSPS 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 24/51 (47%)
Pph13NP_477330.1 Homeobox 14..66 CDD:278475 24/51 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.