DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and HOXB8

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_076921.1 Gene:HOXB8 / 3218 HGNCID:5119 Length:243 Species:Homo sapiens


Alignment Length:144 Identity:43/144 - (29%)
Similarity:64/144 - (44%) Gaps:36/144 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 CSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSE-----DCSDDEGAQSRHEGGGMGGKDSQG 310
            |.||          |.|:.|.....|...:...|.:     ||       ......|: |::::|
Human    78 CHGD----------PGNFYGYDPLQRQSLFGAQDPDLVQYADC-------KLAAASGL-GEEAEG 124

  Fly   311 NGSSSN-------------SKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQ 362
            :..|.:             :..||.|..::..|.||||:||....||:...|.:::.:|.|:|.|
Human   125 SEQSPSPTQLFPWMRPQAAAGRRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQ 189

  Fly   363 VKIWFQNRRAKWKR 376
            |||||||||.|||:
Human   190 VKIWFQNRRMKWKK 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 24/50 (48%)
HOXB8NP_076921.1 Antp-type hexapeptide 134..139 0/4 (0%)
Homeobox 150..203 CDD:395001 26/52 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..243 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.