DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and HOXB1

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_002135.2 Gene:HOXB1 / 3211 HGNCID:5111 Length:301 Species:Homo sapiens


Alignment Length:277 Identity:86/277 - (31%)
Similarity:107/277 - (38%) Gaps:81/277 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 SSPA-----GHPAAQQPQAQAQPQP---PPPHPPTHALEKQLPPTLPHPLDTRFLPFNPAAAGVA 168
            ||||     |:||.|.|.....|.|   |..:.|. |......|:..:||            |.:
Human    53 SSPAFQQNSGYPAQQPPSTLGVPFPSSAPSGYAPA-ACSPSYGPSQYYPL------------GQS 104

  Fly   169 PTDLSYRRLAELMNQDYVHSLSVHARLQHMA----AAGRMHEDQANPGMAQLQEPTPPQAHSSPA 229
            ..|           ..|.|..|..|:|..::    |.|      |.||      |.|||  ..|.
Human   105 EGD-----------GGYFHPSSYGAQLGGLSDGYGAGG------AGPG------PYPPQ--HPPY 144

  Fly   230 KSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGA 294
            .:...:...||....:.||.|   ..|.....|.:.|.::. |...||...|...||        
Human   145 GNEQTASFAPAYADLLSEDKE---TPCPSEPNTPTARTFDW-MKVKRNPPKTAKVSE-------- 197

  Fly   295 QSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLS 359
                          .|.||.|.     .||.||:.||.|||:|||..||||...|.:||.:|:|:
Human   198 --------------PGLGSPSG-----LRTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELN 243

  Fly   360 EVQVKIWFQNRRAKWKR 376
            |.||||||||||.|.|:
Human   244 ETQVKIWFQNRRMKQKK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 32/50 (64%)
HOXB1NP_002135.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..77 10/23 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..149 10/35 (29%)
Antp-type hexapeptide 179..184 0/5 (0%)
Homeobox 207..259 CDD:278475 33/51 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..301 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.