DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and HOXA9

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_689952.1 Gene:HOXA9 / 3205 HGNCID:5109 Length:272 Species:Homo sapiens


Alignment Length:299 Identity:78/299 - (26%)
Similarity:114/299 - (38%) Gaps:69/299 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 GGCYLPSSPAGHPAAQQ-------PQAQAQPQPPPPHPPTHALEKQLPPTLPHPLDTRF----LP 159
            |..|:.|...|..||.:       |....|   ||....|.|......|.......|.|    .|
Human     8 GNYYVDSFLLGADAADELSVGRYAPGTLGQ---PPRQAATLAEHPDFSPCSFQSKATVFGASWNP 69

  Fly   160 FNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAA--GRMHEDQANPGMAQLQEPTPP 222
            .:.|.|...|..:.:.         :.|...||.:....|||  ||.        |....||||.
Human    70 VHAAGANAVPAAVYHH---------HHHHPYVHPQAPVAAAAPDGRY--------MRSWLEPTPG 117

  Fly   223 QAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISL-TMSPRNY---NGEMDKSR---NGAY 280
            ....:...|.....::|       |........|..:.. |:|..:|   :..:|:.:   .||:
Human   118 ALSFAGLPSSRPYGIKP-------EPLSARRGDCPTLDTHTLSLTDYACGSPPVDREKQPSEGAF 175

  Fly   281 TNSDSEDCSDDEGAQSRHEGGGMGGKDS---QGNGSSSN----SKSRRRRTAFTSEQLLELEREF 338
            :.:::|           :|.||    |.   ..|..::|    ..:|::|..:|..|.||||:||
Human   176 SENNAE-----------NESGG----DKPPIDPNNPAANWLHARSTRKKRCPYTKHQTLELEKEF 225

  Fly   339 HAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRV 377
            ....||:...|.::|..|.|:|.||||||||||.|.|::
Human   226 LFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 26/50 (52%)
HOXA9NP_689952.1 Hox9_act 1..193 CDD:309661 47/226 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..198 10/57 (18%)
Homeobox 209..262 CDD:306543 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.