DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment unpg and HOXA6

DIOPT Version :9

Sequence 1:	NP_477146.1	Gene:	unpg / 35942	FlyBaseID:	FBgn0015561	Length:	485	Species:	Drosophila melanogaster
Sequence 2:	NP_076919.1	Gene:	HOXA6 / 3203	HGNCID:	5107	Length:	233	Species:	Homo sapiens

Alignment Length:	131	Identity:	46/131 - (35%)
Similarity:	65/131 - (49%)	Gaps:	2/131 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   248 DFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGN- 311
            |.:.||.|.|.......|.:|.....:.:....::|.......||||..::............:
Human    82 DKDLSGASPSGSGKQRGPGDYLHFSPEQQYKPDSSSGQGKALHDEGADRKYTSPVYPWMQRMNSC 146

  Fly   312 -GSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWK 375
             |:...|..||.|..:|..|.||||:|||..:||:...|.:||.:|.|:|.|:||||||||.|||
Human   147 AGAVYGSHGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWK 211

  Fly   376 R 376
            :
Human   212 K 212

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
unpg	NP_477146.1	Homeobox	324..375	CDD:278475	27/50 (54%)
HOXA6	NP_076919.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	89..127		6/37 (16%)
		Antp-type hexapeptide	136..141		0/4 (0%)
		Homeobox	159..212	CDD:365835	29/52 (56%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	214..233
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0489
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	1	1.000	-	-		X14
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	3	2.810