DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and HOXA3

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001371264.1 Gene:HOXA3 / 3200 HGNCID:5104 Length:443 Species:Homo sapiens


Alignment Length:413 Identity:104/413 - (25%)
Similarity:140/413 - (33%) Gaps:153/413 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 CYL--PSSPAGHPAAQQ------PQAQAQPQPPPP--HPPTHALEKQLPPTLPHPLDTRFLPFNP 162
            |.|  |||..|||.|.:      ....|.|..||.  .||.|....|..|..|.|      | .|
Human    50 CSLQSPSSAGGHPKAHELSEACLRTLSAPPSQPPSLGEPPLHPPPPQAAPPAPQP------P-QP 107

  Fly   163 AAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSS 227
            |....|||                                     .|.|         ||.:.:|
Human   108 APQPPAPT-------------------------------------PAAP---------PPPSSAS 126

  Fly   228 PAKSGSHSP------MEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSE 286
            |.::.|::|      ..|.|:         |......|...|.....|.:...|     ::|..|
Human   127 PPQNASNNPTPANAAKSPLLN---------SPTVAKQIFPWMKESRQNTKQKTS-----SSSSGE 177

  Fly   287 DCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQ 351
            .|:              |.|...|..|     |:|.|||:||.||:|||:|||..:||....|.:
Human   178 SCA--------------GDKSPPGQAS-----SKRARTAYTSAQLVELEKEFHFNRYLCRPRRVE 223

  Fly   352 IATSLKLSEVQVKIWFQNRRAKWKRVKAG---LTSHGLGRNGTTSGTKIVVPIPVHVNRFAVRSQ 413
            :|..|.|:|.|:||||||||.|:|:.:.|   |||.| |::.:.|      |:|.....: :.|.
Human   224 MANLLNLTERQIKIWFQNRRMKYKKDQKGKGMLTSSG-GQSPSRS------PVPPGAGGY-LNSM 280

  Fly   414 HQQLEKM-------------------------------CLSGPKPDLRKKLSAEAIGGFEKF--- 444
            |..:..:                               |...|.|..|...:....||...:   
Human   281 HSLVNSVPYEPQSPPPFSKPPQGTYGLPPASYPASLPSCAPPPPPQKRYTAAGAGAGGTPDYDPH 345

  Fly   445 ------SGSTNASSPSGGPVGLG 461
                  :||.......|.||.:|
Human   346 AHGLQGNGSYGTPHIQGSPVFVG 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 29/50 (58%)
HOXA3NP_001371264.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..147 26/124 (21%)
Antp-type hexapeptide 155..160 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..196 12/60 (20%)
Homeobox 195..248 CDD:395001 30/52 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 247..338 16/98 (16%)
DUF4074 378..441 CDD:404218
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 400..443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.