DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and HMX2

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_005510.1 Gene:HMX2 / 3167 HGNCID:5018 Length:273 Species:Homo sapiens


Alignment Length:195 Identity:53/195 - (27%)
Similarity:88/195 - (45%) Gaps:33/195 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 PQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSR---NGAYTNS 283
            |..|....:...|.|..|...:|..:....||....:.:..:||.:.:.:.:|.|   .|     
Human    68 PDQHGPKEQGPKHHPPIPFPCLGTPKGSGGSGPGGLERTPFLSPSHSDFKEEKERLLPAG----- 127

  Fly   284 DSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTE 348
                 |...|::...:||.         ...:.:..::.||.|:..|:.:||..|..|:|||.:|
Human   128 -----SPSPGSERPRDGGA---------ERQAGAAKKKTRTVFSRSQVYQLESTFDMKRYLSSSE 178

  Fly   349 RSQIATSLKLSEVQVKIWFQNRRAKWKR-----VKAGLTSHGLGRNGTT------SGTKIVVPIP 402
            |:.:|:||:|:|.|||.||||||.||||     ::|...:|...:...:      ..:.:.||:|
Human   179 RACLASSLQLTETQVKTWFQNRRNKWKRQLSAELEAANMAHASAQTLVSMPLVFRDSSLLRVPVP 243

  Fly   403  402
            Human   244  243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 27/50 (54%)
HMX2NP_005510.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..152 17/102 (17%)
Homeobox 152..205 CDD:306543 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.