DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and HMX1

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_061815.2 Gene:HMX1 / 3166 HGNCID:5017 Length:348 Species:Homo sapiens


Alignment Length:441 Identity:103/441 - (23%)
Similarity:152/441 - (34%) Gaps:160/441 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 FSIESLIANQTP----ATATPPSPPEERDQEQEAEQEQELSARAMVASSALGLTQFPLYNPWLHG 91
            |.||:|:|.:..    ||....|..:|.:.:.:.|.|....||                      
Human    19 FLIENLLAAEAKGAGRATQGDGSREDEEEDDDDPEDEDAEQAR---------------------- 61

  Fly    92 YFAQNHERLTHLIAGGCYLPSSPAGHPAAQQ---PQAQA-QPQPPP-PHPPTHALEKQLPPTLPH 151
              .:..:|...|:||     :.|.|...|:.   |.|.. .|:||| |.|               
Human    62 --RRRLQRRRQLLAG-----TGPGGEARARALLGPGALGLGPRPPPGPGP--------------- 104

  Fly   152 PLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQL 216
                   ||.....|                                  |.|.:           
Human   105 -------PFALGCGG----------------------------------AARWY----------- 117

  Fly   217 QEPTPPQAHS------SPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKS 275
                 |:||.      ||..|...|| |...::|..|.....|.....:      :....|: .:
Human   118 -----PRAHGGYGGGLSPDTSDRDSP-ETGEEMGRAEGAWPRGPGPGAV------QREAAEL-AA 169

  Fly   276 RNGAYTNSDSEDCSDDEGAQSRHEGG-GMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFH 339
            |..|....::.:.::...|.....|| |:||           .:.::.||.|:..|:.:||..|.
Human   170 RGPAAGTEEASELAEVPAAAGETRGGVGVGG-----------GRKKKTRTVFSRSQVFQLESTFD 223

  Fly   340 AKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR-VKAGLTSHGLGRNGTTSGTKIVVPIPV 403
            .|:|||..||:.:|.||:|:|.||||||||||.|||| :.|.|.:..|    :..|.:.:|.:||
Human   224 LKRYLSSAERAGLAASLQLTETQVKIWFQNRRNKWKRQLAAELEAASL----SPPGAQRLVRVPV 284

  Fly   404 HVNRFAVRSQHQQLEKMCLSGPKPDLRKKLSAEA-------IGGFEKFSGS 447
                    ..|:.......:||...|...|:..|       :|    |||:
Human   285 --------LYHESPPAAAAAGPPATLPFPLAPAAPAPPPPLLG----FSGA 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 28/50 (56%)
HMX1NP_061815.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..203 49/293 (17%)
Homeobox 206..259 CDD:278475 29/52 (56%)
HMX family specific domain 1 263..273 3/13 (23%)
HMX family specific domain 2 276..289 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.