DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and MNX1

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_005506.3 Gene:MNX1 / 3110 HGNCID:4979 Length:401 Species:Homo sapiens


Alignment Length:398 Identity:107/398 - (26%)
Similarity:139/398 - (34%) Gaps:150/398 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KPFSIESLIANQTPATATPPSPPEERDQEQEAEQEQELSARAMVASSALGL------------TQ 81
            |.|.|::|:|...|..|:..|.|              |:....:|::|.|.            | 
Human     5 KNFRIDALLAVDPPRAASAQSAP--------------LALVTSLAAAASGTGGGGGGGGASGGT- 54

  Fly    82 FPLYNPWLHGYFAQNHERLTHLIAGGCYLPSSPAGH--PAAQQPQAQAQPQPPPPHPPTHALEKQ 144
                                   :|.|    |||..  |||...:.:|:...||.....|.    
Human    55 -----------------------SGSC----SPASSEPPAAPADRLRAESPSPPRLLAAHC---- 88

  Fly   145 LPPTLPHPLDTRFL---------------------PFNPAAAGVAPTDLSYRRLAELMNQDYVHS 188
              ..||.|   .||                     |...|||..|....:...||          
Human    89 --ALLPKP---GFLGAGGGGGGTGGGHGGPHHHAHPGAAAAAAAAAAAAAAGGLA---------- 138

  Fly   189 LSVH-------ARLQHMAA--AGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPA---- 240
            |.:|       |.|...||  ...::...|....|.|....|..::|.|...|:| |..||    
Human   139 LGLHPGGAQGGAGLPAQAALYGHPVYGYSAAAAAAALAGQHPALSYSYPQVQGAH-PAHPADPIK 202

  Fly   241 LDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGG 305
            |..|..:..:....|.:.:.|...| ::|.:                      |||...|     
Human   203 LGAGTFQLDQWLRASTAGMILPKMP-DFNSQ----------------------AQSNLLG----- 239

  Fly   306 KDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNR 370
                        |.||.||||||:||||||.:|...||||..:|.::||||.|:|.|||||||||
Human   240 ------------KCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNR 292

  Fly   371 RAKWKRVK 378
            |.||||.|
Human   293 RMKWKRSK 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 34/50 (68%)
MNX1NP_005506.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..78 12/68 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..120 0/18 (0%)
Homeobox 244..297 CDD:278475 35/52 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 299..401 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.