DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Zfhx4

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_006232224.1 Gene:Zfhx4 / 310250 RGDID:1563022 Length:3619 Species:Rattus norvegicus


Alignment Length:519 Identity:109/519 - (21%)
Similarity:151/519 - (29%) Gaps:184/519 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SPTTRLASKPFPKPFSIESLIANQTPATATPPSPPEERDQEQEAEQEQELSARAMVASSALGLTQ 81
            ||.|     |.|.|           |....||:||:                     .||||..:
  Rat  2005 SPET-----PPPPP-----------PPPPLPPAPPQ---------------------PSALGPVK 2032

  Fly    82 F------PLYNPWLHGYFAQNHERLTHLIAGGCYLPSSPAGHPAAQQPQAQAQPQPPPPHPPTHA 140
            .      ||..|                       |.:|...|....|     |.||||.||:..
  Rat  2033 IPNTVSAPLQAP-----------------------PPTPPPPPPPPPP-----PPPPPPPPPSAP 2069

  Fly   141 LEKQLPPTLPHPLDTRFLPFNPAAAGVAPTDLSYR---------RLAELMNQDYVHSLSVHARLQ 196
            .:.|||.:|..||....: ..|......|..|:.:         .|.:|..|......:.....|
  Rat  2070 PQVQLPVSLDLPLFPSIM-MQPVQHPALPPQLALQLPQMDTLSADLTQLCQQQLGLDPNFLRHSQ 2133

  Fly   197 HMAAAGRMHEDQANPGMAQL---QEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSD 258
            ......|:.:||.....|..   ..|:..|......|||                          
  Rat  2134 FKRPRTRITDDQLKILRAYFDINNSPSEEQIQEMAEKSG-------------------------- 2172

  Fly   259 ISLTMSPRNYNGEMDKSRNGAYTNSDS------------EDCS-DDEGAQSRHEGGGMGGKDSQG 310
            :|..:....:...:.|.|.   .|.||            ||.. |.:.....|            
  Rat  2173 LSQKVIKHWFRNTLFKERQ---RNKDSPYNFSNPPITVLEDIRIDPQPTSLEH------------ 2222

  Fly   311 NGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWK 375
            ..|.::...|..||.||..||..|:..|....|....|..|::|.|.|....:.:||||.|.|.:
  Rat  2223 YKSDASFSKRSSRTRFTDYQLRVLQDFFDTNAYPKDDEIEQLSTVLNLPTRVIVVWFQNARQKAR 2287

  Fly   376 R-----------VKAGLTSHGLGRNGTTSGTK-------IVVPIPVHVNRFAVRSQHQQLEKMCL 422
            :           .|..||:.   |...||..:       :|.|      |......||  :|.|.
  Rat  2288 KSYENQAEAKDNEKRELTNE---RYIRTSNMQYQCKKCNVVFP------RIFDLITHQ--KKQCY 2341

  Fly   423 SGPKPDLRKKLSAE-AIGGFEK-------FSGSTNASSPSGGPVGLGVGVGVGVGVGLGVSTPL 478
            .....|.:.:...| ::...::       .||.|:.:..:..||         ...|.|.||||
  Rat  2342 KDEDDDAQDESQTEDSMDATDQVLYKPCTVSGQTDTAKSTAAPV---------ASSGSGTSTPL 2396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 19/50 (38%)
Zfhx4XP_006232224.1 C2H2 Zn finger 620..641 CDD:275368
C2H2 Zn finger 651..672 CDD:275368
C2H2 Zn finger 706..723 CDD:275368
C2H2 Zn finger 1404..1424 CDD:275371
C2H2 Zn finger 1432..1449 CDD:275371
SFP1 <1489..1616 CDD:227516
C2H2 Zn finger 1548..1572 CDD:275368
C2H2 Zn finger 1600..1618 CDD:275368
COG5576 2106..2245 CDD:227863 31/179 (17%)
HOX 2135..2190 CDD:197696 11/80 (14%)
Homeobox 2234..2288 CDD:395001 20/53 (38%)
PspC_subgroup_1 <2398..>2476 CDD:411407
COG5576 2544..>2666 CDD:227863
Homeobox 2611..2664 CDD:395001
Homeobox 2934..2987 CDD:395001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.