DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Zfhx3

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_038954238.1 Gene:Zfhx3 / 307829 RGDID:1560268 Length:3730 Species:Rattus norvegicus


Alignment Length:547 Identity:112/547 - (20%)
Similarity:172/547 - (31%) Gaps:218/547 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QNGE-IGTME--SPTTRLASKPFPK-----------------------------PFSIESLIANQ 40
            ||.: :..||  :||:...|.|.|.                             .|:.::..:::
  Rat  2375 QNEDSMDAMEILTPTSSSCSTPMPSQAYSTPAPSSASTAPSAFLQLTAETDELATFNSKAEASDE 2439

  Fly    41 TPATATPPSPPEERDQEQEAEQEQELSARAMVASSALGLTQFPLYNPWLHGYFAQNHERLTHLIA 105
            .|..|.|||....:.||::.:.:.|:..:                         :..|:.|::  
  Rat  2440 KPKQADPPSVQPNQTQEKQGQPKPEVQQQ-------------------------EQAEQKTNV-- 2477

  Fly   106 GGCYLPSSPAGHPAAQQPQ--AQAQPQPPPPHPPTHALEKQLPPTLPHPLDTRFLPFNP------ 162
                        |..:.||  |.:.|||||..||...   .||.:.|.|.....||..|      
  Rat  2478 ------------PQPKLPQLAAPSLPQPPPQAPPPQC---PLPQSSPSPSQLSHLPLKPLHTSTP 2527

  Fly   163 -AAAGVAPTDLSYR----RLA-----ELMNQDYVHSLSVHARLQHMAAAGR------MHEDQANP 211
             ..|.:.|..:.|:    :||     .......:|.||...:..|.....|      |..|.:||
  Rat  2528 QQLANLPPQLIPYQCDQCKLAFPSFEHWQEHQQLHFLSAQNQFIHPQFLDRSLDMPFMLFDPSNP 2592

  Fly   212 GMA-QLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKS 275
            .:| ||.....||.   ||.|.: ||..|                      |.:......::::.
  Rat  2593 LLASQLLSGAIPQI---PASSAT-SPSTP----------------------TSTMNTLKRKLEEK 2631

  Fly   276 RNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHA 340
            .:||                      ..|..||.|.|.....:.:|.||..|.|||     |...
  Rat  2632 ASGA----------------------SPGENDSSGTGGEEPQRDKRLRTTITPEQL-----EILY 2669

  Fly   341 KKYL---SLTER--SQIATSLKLSEVQVKIWFQNRRAKWK-----------------------RV 377
            :|||   :.|.:  ..||..:.|.:..|::||||.||:.:                       :.
  Rat  2670 QKYLLDSNPTRKMLDHIAHEVGLKKRVVQVWFQNTRARERKGQFRAVGPAQAHRRCPFCRALFKA 2734

  Fly   378 KAGLTSHGLGRNGTTSGTKIVVPIPVHVNRFAVRSQHQQLEKMCLSGPKPDLRKKLSA---EAIG 439
            |..|.:|                         :||:|....|      :......|||   :..|
  Rat  2735 KTALEAH-------------------------IRSRHWHEAK------RAGYNLTLSAMLLDCDG 2768

  Fly   440 GFEK----FSGSTNASSPSGGPVGLGV 462
            |.:.    |.|::.:..|..|..|.||
  Rat  2769 GLQMKGDIFDGTSFSHLPPSGSDGQGV 2795

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 20/55 (36%)
Zfhx3XP_038954238.1 C2H2 Zn finger 672..692 CDD:275368
C2H2 Zn finger 727..744 CDD:275368
C2H2 Zn finger 1374..1394 CDD:275368
C2H2 Zn finger 1412..1432 CDD:275371
C2H2 Zn finger 1440..1461 CDD:275371
C2H2 Zn finger 1556..1580 CDD:275368
C2H2 Zn finger 1607..1625 CDD:275368
HOX 2156..2212 CDD:197696
Homeobox 2256..2310 CDD:395001
COG5576 2604..2750 CDD:227863 44/223 (20%)
Homeobox 2657..2710 CDD:395001 21/57 (37%)
Homeobox 2961..3014 CDD:395001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.