DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and nkx2.7

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_571494.1 Gene:nkx2.7 / 30694 ZFINID:ZDB-GENE-990415-179 Length:269 Species:Danio rerio


Alignment Length:254 Identity:74/254 - (29%)
Similarity:99/254 - (38%) Gaps:73/254 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 RMHEDQA-NPG--MAQLQEPTPPQAHSSPAKSGS--------HSPME--PALDVGMDEDFECSGD 254
            ::.:.|| |||  |...|:..|.|:........:        :||.:  |...|..| ||:....
Zfish    18 KLEQQQALNPGVFMGVEQDSVPLQSLQLQCMQNTLSRSLDLLYSPEKGIPGEQVKCD-DFDIVRS 81

  Fly   255 SCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKS 319
            ||.      ||.  ..|||       .|.::..|...:.:.|...|..:..|..|        :.
Zfish    82 SCG------SPT--EEEMD-------ANEETSMCPFTDSSYSSKNGETLREKPKQ--------RL 123

  Fly   320 RRR-RTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR------- 376
            ||: |..|:..|:.||||.|..::|||..||..:|.:|||:..||||||||||.|.||       
Zfish   124 RRKPRVLFSQTQVFELERRFKQQRYLSAPERDHLALALKLTSTQVKIWFQNRRYKCKRQRQDKSL 188

  Fly   377 -------------VKAGLTSHGLGRNGTTS----------GTKIVVPIPVHVNRFAVRS 412
                         |:.|...||...|.|.|          |..     |.|.|..:|.|
Zfish   189 ELAGPRRVAVPVLVRDGKPCHGAPYNVTVSYPYNNYYNSYGNN-----PYHCNFTSVPS 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 27/50 (54%)
nkx2.7NP_571494.1 COG5576 87..210 CDD:227863 43/139 (31%)
Homeobox 127..180 CDD:278475 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.