DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Nkx3-1

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001029316.1 Gene:Nkx3-1 / 305999 RGDID:1305369 Length:238 Species:Rattus norvegicus


Alignment Length:279 Identity:70/279 - (25%)
Similarity:103/279 - (36%) Gaps:92/279 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 QQPQAQAQPQPPPPHPPTHALEKQLPPTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDY 185
            |:.:.:|..:.|...|||.:                                  :||...:.||.
  Rat     8 QEARLEAGGRSPWAAPPTQS----------------------------------KRLTSFLIQDI 38

  Fly   186 VHSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFE 250
            :                |.|.::..      .:|:.||....|         :|..|...:.| |
  Rat    39 L----------------RDHAERRG------GQPSTPQHQCQP---------DPKRDSASELD-E 71

  Fly   251 CSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSE------DCSDDEGAQSRHEGGGMGGKDSQ 309
            ..|   |.::|. .|........::|  |.|.||:.      ||.......|..:          
  Rat    72 AEG---SSVTLE-DPPGIRSSPTETR--AETESDAHFETYLLDCEHTPVLSSAPQ---------- 120

  Fly   310 GNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKW 374
                .:....:|.|.||:..|::||||:|..:||||..||:.:|.:|||:|.||||||||||.|.
  Rat   121 ----VTKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKT 181

  Fly   375 KRVKAGLTSHGLGRNGTTS 393
            ||.:.......|.:|.|.|
  Rat   182 KRRQLSEDLGVLEKNSTLS 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 30/50 (60%)
Nkx3-1NP_001029316.1 Homeobox 129..182 CDD:278475 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.