DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and pax7a

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_571400.1 Gene:pax7a / 30587 ZFINID:ZDB-GENE-990415-201 Length:507 Species:Danio rerio


Alignment Length:142 Identity:47/142 - (33%)
Similarity:76/142 - (53%) Gaps:24/142 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 SGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDC--SDDEG-AQSRH--EG--GGMGGKDSQ 309
            ||::.|..|::...|...|:.|          |.::|  .|::| .:::|  :|  |..|.:..:
Zfish   150 SGEASSVSSISRVLRARFGKKD----------DDDECDKKDEDGEKKTKHSIDGILGDKGNRTDE 204

  Fly   310 GNGSSS------NSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQ 368
            |:...|      ..|.||.||.||:|||.|||:.|....|..:..|.::|...||:|.:|::||.
Zfish   205 GSDVESEPDLPLKRKQRRSRTTFTAEQLEELEKAFERTHYPDIYTREELAQRTKLTEARVQVWFS 269

  Fly   369 NRRAKWKRVKAG 380
            ||||:|:: :||
Zfish   270 NRRARWRK-QAG 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 23/50 (46%)
pax7aNP_571400.1 PAX 34..166 CDD:238076 5/15 (33%)
Homeobox 223..276 CDD:278475 24/52 (46%)
Pax7 343..386 CDD:289156
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.