DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment unpg and dlx3b

DIOPT Version :9

Sequence 1:	NP_477146.1	Gene:	unpg / 35942	FlyBaseID:	FBgn0015561	Length:	485	Species:	Drosophila melanogaster
Sequence 2:	NP_571397.2	Gene:	dlx3b / 30585	ZFINID:	ZDB-GENE-980526-280	Length:	269	Species:	Danio rerio

Alignment Length:	117	Identity:	42/117 - (35%)
Similarity:	59/117 - (50%)	Gaps:	26/117 - (22%)

- Green bases have known domain annotations that are detailed below.

  Fly   311 NGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWK 375
            ||..  .|.|:.||.::|.||..|:|.|...:||:|.||:::|..|.|::.||||||||||:|:|
Zfish   119 NGKP--KKIRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFK 181

  Fly   376 RVKAGLTSHGLGRNGTTSGTKIVVPIPVHVNRFAVRSQHQQLEKMCLSGPKP 427
            :         |.:||.       ||:.        .|.:......|.|.|.|
Zfish   182 K---------LYKNGE-------VPLE--------HSPNASDSMACNSPPSP 209

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
unpg	NP_477146.1	Homeobox	324..375	CDD:278475	26/50 (52%)
dlx3b	NP_571397.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..41
		DLL_N	28..104	CDD:289198
		Homeobox	128..181	CDD:278475	27/52 (52%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	191..242		5/27 (19%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	250..269
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	2	1.910