DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and dlx4b

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_571393.1 Gene:dlx4b / 30581 ZFINID:ZDB-GENE-990415-50 Length:254 Species:Danio rerio


Alignment Length:236 Identity:61/236 - (25%)
Similarity:95/236 - (40%) Gaps:62/236 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 PLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDY-VHSLSVHARLQHMAAAGRMHEDQANP-GMA 214
            |..:.||.|....|.      :.:.|:...:..| ||.|.....|||.|.........:.| |.|
Zfish    16 PSKSAFLEFGHGLAS------NQQHLSGFAHNIYPVHGLHSGGHLQHDAPYPSSAPHYSRPLGYA 74

  Fly   215 QLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGA 279
            .   |.|..|    |..|::.|.:|                                  .:.:||
Zfish    75 Y---PGPVSA----AAPGAYMPYQP----------------------------------NNHSGA 98

  Fly   280 YTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYL 344
            ..::.:||.:.::.|...:....:.||         ..|.|:.||.::|.||..|.:.|...:||
Zfish    99 LAHTRAEDTNHEKPAVIENGEIRLNGK---------GKKIRKPRTIYSSVQLQALHQRFQQTQYL 154

  Fly   345 SLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHG 385
            :|.||:.:|..|.|::.||||||||:|:|:|::    ..||
Zfish   155 ALPERADLAAKLGLTQTQVKIWFQNKRSKYKKI----MKHG 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 24/50 (48%)
dlx4bNP_571393.1 Homeobox 132..185 CDD:278475 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.