DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and dlx2a

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_571386.2 Gene:dlx2a / 30574 ZFINID:ZDB-GENE-980526-212 Length:274 Species:Danio rerio


Alignment Length:219 Identity:61/219 - (27%)
Similarity:96/219 - (43%) Gaps:63/219 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 MNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGM 245
            |:.:.:.|.|.|:          :|:.|.:|.:                      |:..|.|...
Zfish    15 MHSNQITSSSYHS----------LHKSQESPTL----------------------PVSTATDSSY 47

  Fly   246 --DEDFECSGDSCSDISL------TMSPRNYNGEMDKSRN----------GAYTNSDSEDCSDDE 292
              :.:.:|:|.....||.      :|:...||   .||..          |.|.:..|...:|.|
Zfish    48 YNNNNQQCAGSPYGQISSYQYQNNSMNSVQYN---TKSYELGFGNAFGPYGTYGSCSSPTPADAE 109

  Fly   293 GAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLK 357
            ..:|..|...:.||.         .|.|:.||.::|.||..|:|.|...:||:|.||:::|.||.
Zfish   110 KEESEPEIRMVNGKP---------KKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLG 165

  Fly   358 LSEVQVKIWFQNRRAKWKRV-KAG 380
            |::.||||||||||:|:|:: |:|
Zfish   166 LTQTQVKIWFQNRRSKFKKLWKSG 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 27/50 (54%)
dlx2aNP_571386.2 DLL_N 32..107 CDD:289198 17/99 (17%)
Homeobox 130..183 CDD:278475 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.