DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and dlx5a

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_571381.2 Gene:dlx5a / 30569 ZFINID:ZDB-GENE-990415-49 Length:282 Species:Danio rerio


Alignment Length:229 Identity:64/229 - (27%)
Similarity:94/229 - (41%) Gaps:66/229 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 RRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEP 239
            ||:..:...|:          |:......||    :|..   :.||.|:  |:...||.:||.. 
Zfish     7 RRIPSIKPADF----------QNPFQLSTMH----HPSQ---ESPTLPE--STATDSGYYSPAG- 51

  Fly   240 ALDVGMDEDFECSGDSCSDISLTM-SPRN-----YNGEMDKSRN--------------------G 278
                |:...:      ||..|.|. .|.|     |:|....|.|                    |
Zfish    52 ----GVHHGY------CSPNSGTYGKPLNAYQYQYHGVNGSSGNYSAKSYPDYGSYSTAYHQYAG 106

  Fly   279 AYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKY 343
            .|....|:. |..|...:..|...:.||.         .|.|:.||.::|.||..|:|.|...:|
Zfish   107 TYNRVQSQP-SPQEKETAEPEVRMVNGKP---------KKVRKPRTIYSSFQLAALQRRFQNTQY 161

  Fly   344 LSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRV 377
            |:|.||:::|.||.|::.||||||||:|:|.|::
Zfish   162 LALPERAELAASLGLTQTQVKIWFQNKRSKLKKI 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 26/50 (52%)
dlx5aNP_571381.2 DLL_N 31..118 CDD:289198 23/103 (22%)
Homeobox 140..193 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.