DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and pax3a

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_571352.1 Gene:pax3a / 30532 ZFINID:ZDB-GENE-980526-52 Length:509 Species:Danio rerio


Alignment Length:118 Identity:45/118 - (38%)
Similarity:64/118 - (54%) Gaps:21/118 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 NSDSEDCSDDE---------GAQSRHE-GGGMGGKDSQGN-GSSSNS--------KSRRRRTAFT 327
            |.| ||..|||         ..:::|. .|.:|.:.|..: ||..:|        |.||.||.||
Zfish   165 NGD-EDEDDDEVEKREIEENERRAKHSIDGILGDRSSHSDEGSDVDSEPGLPLKRKQRRSRTTFT 228

  Fly   328 SEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAG 380
            :|||.||||.|....|..:..|.::|...||:|.:|::||.||||:|:: :||
Zfish   229 AEQLEELERAFERTHYPDIYTREELAQRAKLTEARVQVWFSNRRARWRK-QAG 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 24/50 (48%)
pax3aNP_571352.1 PAX 34..159 CDD:128645
Homeobox 223..276 CDD:278475 25/52 (48%)
Pax7 350..394 CDD:289156
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.