DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and lhx5

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_571293.1 Gene:lhx5 / 30465 ZFINID:ZDB-GENE-980526-484 Length:399 Species:Danio rerio


Alignment Length:261 Identity:63/261 - (24%)
Similarity:99/261 - (37%) Gaps:88/261 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 MDED-FECSGD----------------SCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDE 292
            :||: |.|..|                ||:|.||  ||...:...|.::     .:|:...||  
Zfish   108 IDENKFVCKEDYLSASAIKEVNLNSVSSCTDRSL--SPDLPDQIQDDTK-----ETDNSTSSD-- 163

  Fly   293 GAQSRHEGGGMGGKDSQGN-GSSSNSKSRRR--RTAFTSEQLLELEREFHAKKYLSLTERSQIAT 354
                         ||:..| ....||.::||  ||...::||..|:..|.|....:...|.|:|.
Zfish   164 -------------KDTNNNENEEQNSCTKRRGPRTTIKAKQLETLKAAFVATPKPTRHIREQLAQ 215

  Fly   355 SLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGLGRNGTTSGTKIVVPIPVHVNRFAVRSQHQQLEK 419
            ...|:...:::||||||:|.:|:|. |::.|..|:....|.:.:.|:            ..:||.
Zfish   216 ETGLNMRVIQVWFQNRRSKERRMKQ-LSALGARRHAFFRGPRRMRPL------------GGRLED 267

  Fly   420 MCLSGPKPDLRKKLSAEAIGGFE---KFSG-----------------STNASSPSGGPVGLGVGV 464
            ..:.||             ||:.   ::.|                 |:.|.||:..|..|..|.
Zfish   268 PDIMGP-------------GGYSYYGEYQGDYYGPVVNYDFFPHGPPSSQAHSPAESPYLLSSGS 319

  Fly   465 G 465
            |
Zfish   320 G 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 17/50 (34%)
lhx5NP_571293.1 LIM1_Lhx1_Lhx5 5..56 CDD:188753
LIM2_Lhx1_Lhx5 64..119 CDD:188761 4/10 (40%)
COG5576 126..>242 CDD:227863 38/138 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..185 17/70 (24%)
Homeobox 183..236 CDD:278475 18/52 (35%)
GATA-N 298..>390 CDD:283099 8/23 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 301..399 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.