DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and hoxc3a

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001128157.2 Gene:hoxc3a / 30421 ZFINID:ZDB-GENE-980526-532 Length:263 Species:Danio rerio


Alignment Length:220 Identity:66/220 - (30%)
Similarity:96/220 - (43%) Gaps:62/220 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 DQAN----PGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISL-----T 262
            |:.|    ..::.:|.|      .|.:..|:|| ::||..:..::..|.|....|.:..     |
Zfish    70 DKGNVWNFQNLSNVQHP------YSFSDDGNHS-LDPANALEREKACELSTSCLSTMKYPWMRET 127

  Fly   263 MSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFT 327
            .:|.::      |...|..:.||                    |.|.|.....||.|:|.|.|||
Zfish   128 HAPTHF------SSINAMESGDS--------------------KYSNGEAVVRNSSSKRARVAFT 166

  Fly   328 SEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR-------VKAGLTSHG 385
            |.||||||:|||...||....|.::|..|||::.|:||||||||.|:|:       .|:..|..|
Zfish   167 SSQLLELEKEFHFSAYLCRNRRLEMAELLKLTDRQIKIWFQNRRMKYKKDHKEKSTAKSSYTYLG 231

  Fly   386 -------LGRNGTTSGTKIVVPIPV 403
                   :.|:.|.|      |:|:
Zfish   232 TENQPLIISRSTTDS------PVPL 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 30/50 (60%)
hoxc3aNP_001128157.2 Abdominal-A 123..246 CDD:332641 50/148 (34%)
Homeobox 162..214 CDD:306543 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.