DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and hoxd13a

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_571244.2 Gene:hoxd13a / 30407 ZFINID:ZDB-GENE-990415-119 Length:256 Species:Danio rerio


Alignment Length:258 Identity:66/258 - (25%)
Similarity:103/258 - (39%) Gaps:49/258 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 LDTRFLPFNPAAAGV--------APTDLSYRRLAELMNQDYVHSLSVHARLQ--------HMAAA 201
            ||..|:...|:|.|.        ||...:..|...:.|:......|..:.:.        |:..:
Zfish     6 LDEEFINVYPSAFGTHSSRCTSGAPVLSAVDRPTSVCNESISPYFSFPSNIGSGSFTFGCHLENS 70

  Fly   202 GRMHEDQA-NPGMAQLQEPTPPQAHSSPAKSGSHS----------------PMEPA-LDVGMDED 248
            .::.::.. .||:|:..    .|..:.|...|..|                |..|| :|:.:.:.
Zfish    71 YKVPQNAVFPPGVAKQN----GQFANKPVDHGEASSWLKEFAFYQGCARSYPRIPAFIDLPVVQR 131

  Fly   249 FECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGS 313
             ...||...:..|||....:   .|.|.|    .|....|..|   |:|...........:...:
Zfish   132 -AMMGDLRHETCLTMEGHQH---WDWSNN----CSSQLYCFQD---QTRSPHIWKPSLTEEAAAA 185

  Fly   314 SSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR 376
            |...:.|::|..:|..||.|||||::..|:::...|.:||:|..|||.||.|||||||.|.|:
Zfish   186 SFCQRGRKKRVPYTKFQLKELEREYNTTKFITKENRRRIASSTNLSERQVTIWFQNRRVKDKK 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 26/50 (52%)
hoxd13aNP_571244.2 HoxA13_N 16..>71 CDD:289085 8/54 (15%)
Homeobox 194..247 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.