DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and hoxc11a

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_571240.1 Gene:hoxc11a / 30403 ZFINID:ZDB-GENE-990415-111 Length:306 Species:Danio rerio


Alignment Length:300 Identity:75/300 - (25%)
Similarity:121/300 - (40%) Gaps:63/300 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 GC----YLPSSPAGHPAAQQPQAQA----QPQPPPPHPPTHALEKQLPPTLPHPLD-TRFLPFNP 162
            ||    ||||.     ....|:..|    .||.|         .:|:  |.|:..: ::..|...
Zfish    27 GCASNIYLPSC-----TYYVPEFSAVSSFLPQGP---------SRQI--TYPYSTNLSQVQPVRD 75

  Fly   163 AAAGVAPTDLSYRR---LAELMNQDYVH------SLSVHARLQHMAAAGRMHEDQANPGMAQLQE 218
            .:.|:.|:...:.|   .:....:|.||      |......:::.:.....|:...|        
Zfish    76 VSYGLDPSSKWHHRSNYASCYSGEDLVHRDCLPPSTMTEMLMKNESVYSHHHQHHPN-------- 132

  Fly   219 PTPPQAHSSPAKSGSHSPM--EPALDVGMDEDFE---CSGDSCSDISLTMSPRNYNGEMDKSRNG 278
                   ||...:|.::.:  ...|..|.|..||   ||.|:.|:..|..|..|   :::.|...
Zfish   133 -------SSHPSTGFYTGVGKNNVLPQGFDRFFETAYCSTDNQSEHCLQKSEMN---KLETSSQQ 187

  Fly   279 AYTNSDSEDCSDDEGAQSRHEGGG--MGGKDSQGNGS----SSNSKSRRRRTAFTSEQLLELERE 337
            ....|.:.:...|...:..|...|  .......||.|    ||..::|::|..::..|:.|||||
Zfish   188 PTAVSAAREPEKDPEDEEEHTNSGSCTSAATKDGNASKSSHSSTPRTRKKRCPYSKFQIRELERE 252

  Fly   338 FHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRV 377
            |....|::..:|.|::..|.|::.||||||||||.|.|::
Zfish   253 FFFNVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKKL 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 23/50 (46%)
hoxc11aNP_571240.1 DUF3528 42..177 CDD:288866 31/160 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 177..238 12/63 (19%)
Homeobox 237..290 CDD:278475 24/52 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.