DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and hoxc5a

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_571219.2 Gene:hoxc5a / 30379 ZFINID:ZDB-GENE-980526-533 Length:233 Species:Danio rerio


Alignment Length:232 Identity:64/232 - (27%)
Similarity:89/232 - (38%) Gaps:75/232 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 QLQEPTPPQAHSSPAKSGSHSPMEPA------LDVGMDEDFECSGDSCSDISLTMSPRNYNGEMD 273
            |.|:.:..:.|:.. ..|:||....:      ||:|        |...|.|......|......|
Zfish    12 QTQDASSCRMHTFD-NYGAHSEFHESNYAYEGLDLG--------GSFSSQIPTNSLRREAINTTD 67

  Fly   274 KSRNGAYTNSDSEDCSD---------------DEGAQSRHEGGGM------GGKD---------- 307
            ::|:.|.... ::.||.               ..|..|:...|.|      .||.          
Zfish    68 RARSSAAVQR-TQSCSALGSRSFVSTHGYNPLSHGLLSQKAEGNMEVMEKPSGKSRTDDIKMETT 131

  Fly   308 ----SQGNGS-------------------SSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTER 349
                .|.|.:                   |..|..:|.||::|..|.||||:|||..:||:...|
Zfish   132 SAIKQQTNSTQRQNQSQPQIYPWMTKLHMSHESDGKRSRTSYTRYQTLELEKEFHFNRYLTRRRR 196

  Fly   350 SQIATSLKLSEVQVKIWFQNRRAKWK-----RVKAGL 381
            .:||.:|.|:|.|:||||||||.|||     :||.||
Zfish   197 IEIANNLCLNERQIKIWFQNRRMKWKKDSKLKVKGGL 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 28/50 (56%)
hoxc5aNP_571219.2 Homeobox 169..222 CDD:278475 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.