DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Hoxb1

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_220896.4 Gene:Hoxb1 / 303491 RGDID:1310298 Length:297 Species:Rattus norvegicus


Alignment Length:327 Identity:98/327 - (29%)
Similarity:127/327 - (38%) Gaps:79/327 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 EQELSARAMVASSALGLTQFPLYN-PWLHGYFAQNHERLTHLIAGGCYLPSSPAGHPAAQQPQAQ 126
            |..|..|...|.||  .|.||..: |.:..|..::.      ..||  ||||     |.||....
  Rat    11 EYPLCNRGPSAYSA--PTSFPPSSAPAVDSYAGESR------YGGG--LPSS-----ALQQNSGY 60

  Fly   127 AQPQPPPPHPPTHALEKQLPPTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQ-DYVHSLS 190
            ...|||      .:|....|.:.|.       .:.|||...:.....|..:.:.... .|.|..|
  Rat    61 PVQQPP------SSLGVSFPSSAPS-------GYAPAACNPSYGPSQYYSMGQSEGDGGYFHPSS 112

  Fly   191 VHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDS 255
            ..|:|      |.:.:.....|:.....| |||   .|..:...|....|.|: :.||.|   .|
  Rat   113 YGAQL------GGLPDSYGAGGVGSGPYP-PPQ---PPYGTEQTSNFASAYDL-LSEDKE---SS 163

  Fly   256 CSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSR 320
            ||....:::.|.::. |...||...|...||                      .|.|:...    
  Rat   164 CSSEPSSLTARTFDW-MKVKRNPPKTAKVSE----------------------LGLGTPGG---- 201

  Fly   321 RRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWK-------RVK 378
             .||.||:.||.|||:|||..||||...|.:||.:|:|:|.||||||||||.|.|       ||.
  Rat   202 -LRTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQVKIWFQNRRMKQKKREREGGRVP 265

  Fly   379 AG 380
            ||
  Rat   266 AG 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 32/50 (64%)
Hoxb1XP_220896.4 Homeobox 203..255 CDD:278475 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.