DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Hoxb3

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001100512.1 Gene:Hoxb3 / 303488 RGDID:1310780 Length:429 Species:Rattus norvegicus


Alignment Length:409 Identity:106/409 - (25%)
Similarity:147/409 - (35%) Gaps:142/409 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 PPHPPTHALEKQLPPTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQH 197
            ||.||..|                                     |..:..||..|......|.:
  Rat    32 PPQPPFQA-------------------------------------ATHLEGDYQRSACSLQSLGN 59

  Fly   198 MAAAGRMHEDQAN---PGMAQLQEPTPPQA----------------HSSPAKSGSHSPMEPALDV 243
            .|...:..|...:   ||:|....|.||.:                ...|:|||..         
  Rat    60 AAPHAKSKELNGSCMRPGLAPEPLPAPPGSPPPSAAPTSTTSNSNNGGGPSKSGPP--------- 115

  Fly   244 GMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDS----EDCSDDEGAQSRHEGGGMG 304
                  :|...|.|.::..:.|     .|.:||..:...:.|    |.|....|      |||.|
  Rat   116 ------KCGASSNSTLTKQIFP-----WMKESRQTSKLKNSSPGTAEGCGGGGG------GGGGG 163

  Fly   305 GKDSQGNGSS---------SNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSE 360
            |..|.|.||.         .::.|:|.|||:||.||:|||:|||..:||....|.::|..|.|||
  Rat   164 GSSSGGGGSGGGGGDKSPPGSAASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSE 228

  Fly   361 VQVKIWFQNRRAKWKR-VKA-GLTSHGLGRN---------GTTSGTKIVV---------PIPV-- 403
            .|:||||||||.|:|: .|| ||.|...|.:         .:|:|....:         |.|.  
  Rat   229 RQIKIWFQNRRMKYKKDQKAKGLASSSGGPSPAGSPPQPMQSTAGFMNALHSMTPSYDSPSPPAF 293

  Fly   404 ---HVNRFAVRSQHQQLEKMCLS------GPKPDLRKKLSAEAIGGFEKFSGSTNASSPSGGPVG 459
               |.|.:|:.|.:|...|.|.:      .|.|:....: .:|.|      |:....:..|.||.
  Rat   294 SKGHQNAYALPSNYQPPLKGCGAPQKYPPTPAPEYESHV-LQANG------GAYGTPTMQGSPVY 351

  Fly   460 LGVGVGVGVGVGLGVSTPL 478
            :|.|         |.:.||
  Rat   352 VGGG---------GYADPL 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 30/50 (60%)
Hoxb3NP_001100512.1 Homeobox 191..244 CDD:395001 31/52 (60%)
DUF4074 365..427 CDD:404218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.