DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Hoxb13

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001100511.1 Gene:Hoxb13 / 303480 RGDID:1309113 Length:286 Species:Rattus norvegicus


Alignment Length:288 Identity:74/288 - (25%)
Similarity:107/288 - (37%) Gaps:60/288 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 SSP-AGHPAAQQPQAQAQPQPPPPHPPTHALEKQLPPTLPHPLDTRFLPFNPAAAGVAPTDLSYR 175
            ||| |.||||           |...|..:.....||.:...|......|..|..|..||....| 
  Rat    31 SSPLASHPAA-----------PTLMPTVNYAPLDLPGSAEPPKQCHPCPGVPQGASPAPVPYGY- 83

  Fly   176 RLAELMNQDY----VHSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSP 236
                 ....|    |...|:....|....|....|..| ||......||  :....|...|.:.|
  Rat    84 -----FGGGYYSCRVSRSSLKPCAQTATLATYPSETPA-PGEEYPSRPT--EFAFYPGYPGPYQP 140

  Fly   237 MEPALDVGMDEDFECSGDSCSDISLTMS-------PRNYNGEM----DKSRNGAYTNSDSEDCS- 289
            |...|||.:.:.....|:...|..|.:.       ...:|.:|    :::..|.:..:...:.| 
  Rat   141 MASYLDVSVVQTLGAPGEPRHDSLLPVDSYQPWALAGGWNSQMCCQGEQNPPGPFWKAAFAEPSV 205

  Fly   290 ---DDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQ 351
               ..:|...|                    :.|::|..::..||.|||||:.|.|:::..:|.:
  Rat   206 QHPPPDGCAFR--------------------RGRKKRIPYSKGQLRELEREYAANKFITKDKRRK 250

  Fly   352 IATSLKLSEVQVKIWFQNRRAKWKRVKA 379
            |:.:..|||.|:.|||||||.|.|:|.|
  Rat   251 ISAATSLSERQITIWFQNRRVKEKKVLA 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 23/50 (46%)
Hoxb13NP_001100511.1 HoxA13_N 12..122 CDD:289085 28/108 (26%)
HOX 218..274 CDD:197696 25/55 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.