DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and hoxb2a

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_571191.1 Gene:hoxb2a / 30338 ZFINID:ZDB-GENE-990415-103 Length:390 Species:Danio rerio


Alignment Length:206 Identity:63/206 - (30%)
Similarity:86/206 - (41%) Gaps:48/206 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 AAGRMHEDQANPGMAQLQEPTPPQAH-SSPAKSGSHSPMEPALDVGMDEDF----------ECSG 253
            |..|..:..|:.|:....:..||..| ..||.....:|:.        .:|          :|..
Zfish    62 ARPRSQKRTASNGLQLRTQTAPPTQHQQGPAPLSGGAPLA--------HEFPWMKEKKSSKKCPK 118

  Fly   254 DSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSK 318
            ...:..:...||        ...:..||.:..|..::.:|                  |..:.|.
Zfish   119 PGATAAAAAASP--------SQASSGYTTAGLESPTEIQG------------------GLDNVSG 157

  Fly   319 SRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTS 383
            |||.|||:|:.||||||:|||..|||....|.:||..|.|:|.|||:||||||.|.||   ..|.
Zfish   158 SRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKR---QTTH 219

  Fly   384 HGLGRNGTTSG 394
            |..|:.|..||
Zfish   220 HRDGQEGEPSG 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 31/50 (62%)
hoxb2aNP_571191.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..73 3/10 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..100 5/18 (28%)
Antp-type hexapeptide 103..108 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 108..155 8/72 (11%)
Homeobox 162..214 CDD:278475 32/51 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 211..338 9/23 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.