DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and hoxb1a

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_571190.2 Gene:hoxb1a / 30337 ZFINID:ZDB-GENE-990415-101 Length:316 Species:Danio rerio


Alignment Length:277 Identity:81/277 - (29%)
Similarity:115/277 - (41%) Gaps:66/277 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 HPLDTRFL-PFNPAAAGVAPTDLSYRRLAEL----MNQ------DYVHSLSVHARLQHMAAAG-- 202
            |.||..|. ||:...|    :| ||.....|    .||      .:.|...::|..||....|  
Zfish    29 HHLDQAFPGPFHTGHA----SD-SYNADGRLYVGGSNQPPTAAAQHQHQNGIYAHHQHQNQTGMG 88

  Fly   203 --------RMHEDQ--ANPGMAQLQEPTPPQA-----HSSPAKSGSHSPMEPALDVGMDEDFECS 252
                    ..:..|  ||...||.|....|:.     |||...:.:.||...::          :
Zfish    89 LTYGGTGTTSYGTQACANSDYAQHQYFINPEQDGMYYHSSGFSTSNASPHYGSM----------A 143

  Fly   253 GDSC-SDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMG------------ 304
            |..| :..::..:|..::|...:....||:.....|.|..:|.:...:....|            
Zfish   144 GAYCGAQGAVPAAPYQHHGCEGQDHQRAYSQGTYADLSASQGTEKDTDQPPPGKTFDWMKVKRNP 208

  Fly   305 ---GKDSQ-GNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKI 365
               ||.:: |.|..:..     ||.||::||.|||:|||..|||:...|.:||.:|:|:|.||||
Zfish   209 PKTGKVAEYGLGPQNTI-----RTNFTTKQLTELEKEFHFSKYLTRARRVEIAATLELNETQVKI 268

  Fly   366 WFQNRRAKW-KRVKAGL 381
            ||||||.|. ||.|.||
Zfish   269 WFQNRRMKQKKREKEGL 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 31/51 (61%)
hoxb1aNP_571190.2 Homeobox 226..278 CDD:278475 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.