DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and hoxa2b

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_571181.1 Gene:hoxa2b / 30325 ZFINID:ZDB-GENE-990415-98 Length:363 Species:Danio rerio


Alignment Length:205 Identity:62/205 - (30%)
Similarity:90/205 - (43%) Gaps:40/205 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 ANPGMAQLQEPTPP-----QAHSSPAKSGSHS-----PME---PALDVGM----DEDFECSGDSC 256
            :.|.:|:.....||     |:.|..:.:.|||     |.|   |:|:.|.    ....:....||
Zfish    14 SQPSLAECLTSFPPVGDAFQSSSIKSSTLSHSTLIPPPFEQTIPSLNPGSHPRHSRPKQNPNGSC 78

  Fly   257 SDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSD-------DEGAQSRHEGGGMGGKDSQGNGSS 314
             .:.....|..|....:|..:.....:.:...:|       .:|:....:||             
Zfish    79 -PLPAASLPPEYPWMKEKKASKKNQTTSTAATTDPGPLYFSPQGSPEISDGG------------- 129

  Fly   315 SNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR-VK 378
             :..:||.|||:|:.||||||:|||..|||....|.:||..|.|:|.|||:||||||.|.|| .:
Zfish   130 -SGATRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQ 193

  Fly   379 AGLTSHGLGR 388
            .....||.|:
Zfish   194 CKENHHGDGK 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 31/50 (62%)
hoxa2bNP_571181.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..132 17/104 (16%)
Antp-type hexapeptide 88..93 1/4 (25%)
Homeobox 137..189 CDD:278475 32/51 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..218 6/18 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 245..279
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.