DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and noto

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_571130.1 Gene:noto / 30260 ZFINID:ZDB-GENE-990415-75 Length:241 Species:Danio rerio


Alignment Length:237 Identity:63/237 - (26%)
Similarity:97/237 - (40%) Gaps:66/237 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 SYRRLAELMNQDYV---------HSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSP 228
            :|.:.|..::|||.         .|.::.|.|             |.|..|:::|.|  .|:.|.
Zfish    10 TYGQSARPLHQDYATSSSKPSTGKSFTIDALL-------------ARPDQAEMRERT--NAYRSI 59

  Fly   229 AKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMS--------PRNYNGEMDKSRNGAYTNSDS 285
            ......|.....|.......|..|    ..|..|.:        |.|:    ..:..||....|:
Zfish    60 TNQTPVSSSALPLIYSQMPHFAYS----QSIMQTQTGYPVFCYPPYNF----QTTCRGAVYAQDA 116

  Fly   286 EDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERS 350
            ........:..:|:.|                ||:|.||:||::||..||:||..::|:..:||.
Zfish   117 VLAKAAVHSHYKHKSG----------------KSKRMRTSFTNDQLSRLEKEFARQQYMVGSERF 165

  Fly   351 QIATSLKLSEVQVKIWFQNRRAKWKR----------VKAGLT 382
            .:|::|:|:|.|||:||||||.||::          .|.|||
Zfish   166 LLASALQLTEAQVKVWFQNRRIKWRKQSLEQQQAKLAKLGLT 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 26/50 (52%)
notoNP_571130.1 COG5576 79..>193 CDD:227863 42/137 (31%)
Homeobox 138..190 CDD:278475 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.