DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and RAX

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_038463.2 Gene:RAX / 30062 HGNCID:18662 Length:346 Species:Homo sapiens


Alignment Length:287 Identity:67/287 - (23%)
Similarity:95/287 - (33%) Gaps:121/287 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 AAGRMHEDQ---ANPGMAQL----QEPTPPQAHSSPAKSGSHS------PMEPALDVGMDEDFEC 251
            |.|....|:   |.|...:.    .||:||.|   ||.:..:.      |.||            
Human    57 ARGAKERDRRLGARPACPKAPEEGSEPSPPPA---PAPAPEYEAPRPYCPKEP------------ 106

  Fly   252 SGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSN 316
             |::.....|.:.|.....::                |::|..:.:|                  
Human   107 -GEARPSPGLPVGPATGEAKL----------------SEEEQPKKKH------------------ 136

  Fly   317 SKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGL 381
               ||.||.||:.||.||||.|....|..:..|.::|..:.|.||:|::|||||||||:|     
Human   137 ---RRNRTTFTTYQLHELERAFEKSHYPDVYSREELAGKVNLPEVRVQVWFQNRRAKWRR----- 193

  Fly   382 TSHGLGRNGTTSGTKIVVPIPVHVNRFAVRSQHQQLEKMCLSGPKPDLRKKLSAEAIGGFEKFSG 446
                                               .||:.:|.      .||....:..|.:   
Human   194 -----------------------------------QEKLEVSS------MKLQDSPLLSFSR--- 214

  Fly   447 STNASSPSG--GPVGLGVGVGVGVGVG 471
                |.||.  .|:|.|.|.|.|...|
Human   215 ----SPPSATLSPLGAGPGSGGGPAGG 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 25/50 (50%)
RAXNP_038463.2 Octapeptide motif 33..40
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..145 26/140 (19%)
Homeobox 140..192 CDD:278475 26/51 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..318 16/57 (28%)
OAR 319..335 CDD:281777
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 323..336
Nuclear localization signal. /evidence=ECO:0000255 329..333
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.