DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Hoxa9

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_003752231.1 Gene:Hoxa9 / 297099 RGDID:1310001 Length:271 Species:Rattus norvegicus


Alignment Length:306 Identity:76/306 - (24%)
Similarity:114/306 - (37%) Gaps:84/306 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 GGCYLPSSPAGHPAAQQ-------PQAQAQPQPPPPHPPTHALEKQLPPTLPHP----------- 152
            |..|:.|...|..||.:       |.|..|||            :|......||           
  Rat     8 GNYYVDSFLLGADAADELGAGRYAPGALGQPQ------------RQAAALAEHPDFSPCSFQSKA 60

  Fly   153 --LDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQ 215
              ....:.|.:.|.|...|..:.:..     :..|||.   .|.:...|..||.        |..
  Rat    61 AVFGASWNPVHAAGANAVPAAVYHHH-----HHPYVHP---QAPVAAAAPDGRY--------MRS 109

  Fly   216 LQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISL-TMSPRNY---NGEMDKSR 276
            ..||||.....:...|.....::|       |........|..:.. |:|..:|   :..:|:.:
  Rat   110 WLEPTPGALSFAGLPSSRPYGIKP-------EPLSARRGDCPTLDTHTLSLTDYACGSPPVDREK 167

  Fly   277 ---NGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDS---QGNGSSSN----SKSRRRRTAFTSEQL 331
               .||::.:::|           :|.||    |.   ..|..::|    ..:|::|..:|..|.
  Rat   168 QPSEGAFSENNAE-----------NESGG----DKPPIDPNNPAANWLHARSTRKKRCPYTKHQT 217

  Fly   332 LELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRV 377
            ||||:||....||:...|.::|..|.|:|.||||||||||.|.|::
  Rat   218 LELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 26/50 (52%)
Hoxa9XP_003752231.1 Hox9_act 1..192 CDD:398350 45/233 (19%)
Homeobox 208..262 CDD:395001 27/53 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.