DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Hmx2

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001099773.1 Gene:Hmx2 / 293538 RGDID:1565366 Length:273 Species:Rattus norvegicus


Alignment Length:197 Identity:57/197 - (28%)
Similarity:90/197 - (45%) Gaps:37/197 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 PQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSR---NGAYTNS 283
            |..|.....|..|.|..|...:|..:....:|.:.|:.:..:||.:.:.:.:|.|   .|     
  Rat    68 PDPHGPKEPSPKHHPPIPFPCLGTPKGSGGAGPAASERTPFLSPSHPDFKEEKERLLPAG----- 127

  Fly   284 DSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTE 348
                 |...|.:...:||.         ...:.:..::.||.|:..|:.:||..|..|:|||.:|
  Rat   128 -----SPSPGPERPRDGGA---------ERQAGAAKKKTRTVFSRSQVYQLESTFDMKRYLSSSE 178

  Fly   349 RSQIATSLKLSEVQVKIWFQNRRAKWKR-----VKAGLTSHGLGRNGTTSGTKIV--------VP 400
            |:.:|:||:|:|.|||.||||||.||||     ::|...:|...:  |..|..:|        ||
  Rat   179 RACLASSLQLTETQVKTWFQNRRNKWKRQLSAELEAANMAHASAQ--TLVGMPLVFRDSSLLRVP 241

  Fly   401 IP 402
            :|
  Rat   242 VP 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 27/50 (54%)
Hmx2NP_001099773.1 Homeobox 152..206 CDD:395001 29/53 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.