DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Dbx1

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001009644.1 Gene:Dbx1 / 292934 RGDID:1308896 Length:335 Species:Rattus norvegicus


Alignment Length:383 Identity:85/383 - (22%)
Similarity:123/383 - (32%) Gaps:146/383 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 LPSSPAGHPAAQQPQAQAQPQPPPPHPPTHALEKQL--------------------PPT-LPHPL 153
            |.:.|||:|:..:|            .||..|.:.|                    ||| ||..:
  Rat     6 LLAPPAGYPSLLRP------------TPTLTLPQSLQSAFSGHSSFLVEDLIRISRPPTYLPRSI 58

  Fly   154 DTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQLQE 218
            .|..|  :|... .|||.|:....::|.:                ..:|..........::...|
  Rat    59 PTASL--SPPRQ-EAPTALADSGTSDLGS----------------PGSGSRRGSSPQTALSPASE 104

  Fly   219 PT------------PPQAHSSPAKSGSHSPMEPALDV--GMDEDFECSGDSCSDISLTMSPRNYN 269
            ||            .|:..:|||...|..|...|...  |..:.|..|....:..|:...|..::
  Rat   105 PTFLKFGVNAILSSAPRRETSPALLQSPPPKTFAFPYFEGSFQPFIRSSYFPASSSVVPIPGTFS 169

  Fly   270 GEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRR---RRTAFTSEQL 331
            ..:                                         ::..|.||   ||..|:..|.
  Rat   170 WPL-----------------------------------------AARGKPRRGMLRRAVFSDVQR 193

  Fly   332 LELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVK-AGLTSHGLGRNGTTSGT 395
            ..||:.|..:||:|..:|.::|:.|.|.:.||||||||||.||:..| ..|.|.|..|..|    
  Rat   194 KALEKTFQKQKYISKPDRKKLASKLGLKDSQVKIWFQNRRMKWRNSKERELLSSGGCREQT---- 254

  Fly   396 KIVVPIPVHVNRFAVRSQHQQLEKMCLSGPKPDLRKKLSAEAIGGFEKFSGSTNASSP 453
                 :|..:|                  |.|||      ..:|  :|..|.....||
  Rat   255 -----LPTKLN------------------PHPDL------SDVG--QKGPGDEEEDSP 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 23/50 (46%)
Dbx1NP_001009644.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 56..102 9/64 (14%)
Homeobox 184..237 CDD:278475 25/52 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..335 17/77 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.