DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Gsx1

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001178592.1 Gene:Gsx1 / 288457 RGDID:1310020 Length:261 Species:Rattus norvegicus


Alignment Length:319 Identity:87/319 - (27%)
Similarity:106/319 - (33%) Gaps:137/319 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 YLPSSPAGHPAAQQPQAQAQPQPPPPH--PPTHALE------------------------KQL-- 145
            :|..|.....|:.:...:..|.|..|:  ||.|||.                        .||  
  Rat     5 FLVDSLVLREASDKKAPEGSPPPLFPYAVPPPHALHGLSPGACHARKAGLLCVCPLCVTASQLHG 69

  Fly   146 ---PPTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHED 207
               ||.|| .|...|.||                     ...|.|           |..||.|  
  Rat    70 PPGPPALP-LLKASFPPF---------------------GSQYCH-----------APLGRQH-- 99

  Fly   208 QANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEM 272
            ..:||:          |||..|.:.:.:..:.:..:.....|.|       ||:           
  Rat   100 SVSPGV----------AHSPAAAAAAAALYQTSYPLPDPRQFHC-------ISV----------- 136

  Fly   273 DKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNS--KSRRRRTAFTSEQLLELE 335
                                                   .||||.  .|:|.||||||.||||||
  Rat   137 ---------------------------------------DSSSNQLPSSKRMRTAFTSTQLLELE 162

  Fly   336 REFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGLGRNGTTSG 394
            |||.:..|||...|.:|||.|.|||.||||||||||.|.|  |.|..|:..|..|..:|
  Rat   163 REFASNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHK--KEGKGSNHRGGAGAGAG 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 36/50 (72%)
Gsx1NP_001178592.1 Homeobox 150..202 CDD:278475 37/51 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.