DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Evx2

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_221512.6 Gene:Evx2 / 288155 RGDID:1305594 Length:474 Species:Rattus norvegicus


Alignment Length:209 Identity:69/209 - (33%)
Similarity:95/209 - (45%) Gaps:24/209 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 SLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEP------ALDVGMD 246
            |..:|..|..:.|.|:...|.    :..||.|:.....||...|.:.|..:|      |.:..|.
  Rat    55 SAPLHGALGDLPAKGKFEIDT----LFNLQHPSSESTVSSEIASATESRKKPSHYSEAAAEADMS 115

  Fly   247 EDFECSGDSCSDISLTMSPRNYNGEMDKSRNG-AYTNSDS----EDCSDDEGAQSRHEGGG--MG 304
            .|.|.   .||.:   .||........|..|. .|..|.|    ...:...|..|.|.|||  .|
  Rat   116 SDVEV---GCSAL---RSPSGLGAAQLKENNAKGYAESGSVAGTTTSATGSGLGSLHGGGGGNSG 174

  Fly   305 GKDSQGNGSSSNS-KSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQ 368
            |....|:||.|.: :.||.|||||.||:..||:||:.:.|:|...|.::|.:|.|.|..:|:|||
  Rat   175 GAALGGSGSGSGADQVRRYRTAFTREQIARLEKEFYRENYVSRPRRCELAAALNLPETTIKVWFQ 239

  Fly   369 NRRAKWKRVKAGLT 382
            |||.|.||.:..::
  Rat   240 NRRMKDKRQRLAMS 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 25/50 (50%)
Evx2XP_221512.6 Homeobox 194..247 CDD:395001 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.