DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Hoxd4

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001099355.1 Gene:Hoxd4 / 288153 RGDID:1309690 Length:251 Species:Rattus norvegicus


Alignment Length:224 Identity:63/224 - (28%)
Similarity:90/224 - (40%) Gaps:72/224 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 PGMAQLQEPTPPQAH-SSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDK 274
            ||.|     .|.:.| ..|:..|||              :...|:.|.    ...|....|    
  Rat    69 PGSA-----LPARGHGQEPSGPGSH--------------YSAPGEPCP----APPPAPLPG---- 106

  Fly   275 SRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKD-------------SQGNGSSSNSKSRRRRTAF 326
                      :..||...|.:....|..:  |.             :..|.:.:..:.:|.|||:
  Rat   107 ----------ARACSQPTGPKQPPPGTAL--KQPAVVYPWMKKVHVNSVNPNYTGGEPKRSRTAY 159

  Fly   327 TSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGL----G 387
            |.:|:||||:|||..:||:...|.:||.:|.|||.|:||||||||.|||:      .|.|    |
  Rat   160 TRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKK------DHKLPNTKG 218

  Fly   388 RNGTTSGTKIVVPIPVHVNRFAVRSQHQQ 416
            |:.::|.:         .:..|..|||.|
  Rat   219 RSSSSSSS---------CSSSAAPSQHLQ 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 30/50 (60%)
Hoxd4NP_001099355.1 Homeobox 155..209 CDD:395001 32/53 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.