DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Hoxd3

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001257967.1 Gene:Hoxd3 / 288152 RGDID:1588601 Length:432 Species:Rattus norvegicus


Alignment Length:463 Identity:108/463 - (23%)
Similarity:153/463 - (33%) Gaps:182/463 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 ATP--PSPPEERDQEQEAEQEQELSARAMVASSALGLTQFPLYNPWLHGYFAQNHERLTHLIAGG 107
            :||  |.||.......:::..   |:...:.|||      ||..|...|  |:        :.|.
  Rat    44 STPHQPYPPPAAANSLDSDYP---SSACSIQSSA------PLRAPAHKG--AE--------LNGS 89

  Fly   108 CYLP---SSPAGHPAAQQPQAQAQPQPPPPHPPTHALEKQLPPTLPHPLDTRFLPFNPAAAGVAP 169
            |..|   :|..|....|.|...::.|||.|.||        |||||        |.:|       
  Rat    90 CMRPGTGNSQGGGGGNQPPGLNSEQQPPQPPPP--------PPTLP--------PSSP------- 131

  Fly   170 TDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSH 234
                                                   .|||            ...|||... 
  Rat   132 ---------------------------------------TNPG------------SGVPAKKTK- 144

  Fly   235 SPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNS---DSEDCSDDEGAQS 296
                             .|.:.|..|.|:|.:.:....:..:|....||   ..|:|.|.     
  Rat   145 -----------------GGPNASSSSSTISKQIFPWMKESRQNSKQKNSCATSGENCEDK----- 187

  Fly   297 RHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEV 361
                            |.....|:|.|||:||.||:|||:|||..:||....|.::|..|.|:|.
  Rat   188 ----------------SPPGPASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTER 236

  Fly   362 QVKIWFQNRRAKWKR-VKA-GLTSHGLGRN-----------GTTSGTKIVVPIP----------- 402
            |:||||||||.|:|: .|| |:.....|::           |..:.:..:.|:|           
  Rat   237 QIKIWFQNRRMKYKKDQKAKGILHSPAGQSPERSPPLGGAAGHVAYSGQLPPVPGLAYDAPSPPA 301

  Fly   403 ---VHVNRFAVRSQHQQLEKMCLSGPK----PDLRKKLSAEAIGGF--EKFSGS--------TNA 450
               ...|.:.:.:....|.. ||...|    |:......|...|||  ....||        .::
  Rat   302 FAKSQPNMYGLAAYTAPLSS-CLPQQKRYAAPEFEPHPMASNGGGFASANLQGSPVYVGGNFVDS 365

  Fly   451 SSPSGGPV 458
            .:|:.|||
  Rat   366 MAPASGPV 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 29/50 (58%)
Hoxd3NP_001257967.1 Homeobox 198..251 CDD:395001 30/52 (58%)
DUF4074 369..430 CDD:404218 3/5 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.