DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and ind

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster


Alignment Length:435 Identity:110/435 - (25%)
Similarity:149/435 - (34%) Gaps:165/435 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ERPALLQNGE-IGTM-ESPTTRLASKPFPKPFSIESLIANQTPATATPPSPPE-----------E 53
            :||.|.|..| :|:. .|||...|           ...|...|:....|.|..           :
  Fly    13 DRPNLSQKKEKLGSPGGSPTAAAA-----------VAAAAMLPSIPMLPYPASYVGSYLFSLGIQ 66

  Fly    54 RDQEQEAEQEQELSARAMVASSALGLTQFP--------LYNPWLHGYFAQ-------NHERLTHL 103
            :.|:|:.:|:|..:|.|..|::|..|.|.|        ||:|:...:.::       |:|     
  Fly    67 QQQQQQQQQQQHAAAAAAAAAAAAALQQHPHVSSSPGSLYHPYAQLFASKRKSSGFSNYE----- 126

  Fly   104 IAGGCYLPSSPAGHPAAQQPQAQAQPQPPPPHPPTHALEKQLPPTLPHPLDTRFLPFNPAAAGVA 168
               |||                   |.||....|.   .:||||                     
  Fly   127 ---GCY-------------------PSPPLSANPN---SQQLPP--------------------- 145

  Fly   169 PTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGS 233
                             :|:|                  ..:|.:..|..|.|....:||:.|.|
  Fly   146 -----------------IHNL------------------YGSPVVGGLPLPEPGSFCTSPSASSS 175

  Fly   234 HSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRH 298
            .|     ||                         |....|:.:...:.:..|  ||.:......|
  Fly   176 AS-----LD-------------------------YTNNFDEPQGKRFKHESS--CSPNSSPLKNH 208

  Fly   299 EGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQV 363
            ..||........|..:.:||  |.||||||.|||||||||....|||...|.:||..|:|||.||
  Fly   209 SSGGPVEITPLINDYADSSK--RIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQV 271

  Fly   364 KIWFQNRRAKWKRVKAGLTSH----GLGRNGTTSGTKIVVPIPVH 404
            ||||||||.|.|  |.|..|.    ....||:...:.:...:.||
  Fly   272 KIWFQNRRVKQK--KGGSESPTFNLSTNSNGSPQASPVSPQVKVH 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 35/50 (70%)
indNP_996087.2 Homeobox 231..283 CDD:278475 36/51 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.