DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and ALX3

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_006483.2 Gene:ALX3 / 257 HGNCID:449 Length:343 Species:Homo sapiens


Alignment Length:390 Identity:104/390 - (26%)
Similarity:133/390 - (34%) Gaps:114/390 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 AGGCYL-----PSSPAGHPAAQQPQAQAQPQPPPPHPPTHALEKQLPPTLPHPLDTRFLPFNPAA 164
            |.|.|:     |..|.|.|||          .|..||        .||..|..  |||    ||.
Human    14 APGPYVASGDEPPGPQGTPAA----------APHLHP--------APPRGPRL--TRF----PAC 54

  Fly   165 AGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPA 229
            ..:.|               |:                   .:.|.|....||:..|     .||
Human    55 GPLEP---------------YL-------------------PEPAKPPAKYLQDLGP-----GPA 80

  Fly   230 KSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGA 294
            .:|.|....||      |..|.:..:.|...|.:..|  .|..|...|   .......|     .
Human    81 LNGGHFYEGPA------EAEEKTSKAASFPQLPLDCR--GGPRDGPSN---LQGSPGPC-----L 129

  Fly   295 QSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLS 359
            .|.|.....|..||. ..:.:.||.||.||.|::.||.|||:.|....|..:..|.|:|....|:
Human   130 ASLHLPLSPGLPDSM-ELAKNKSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLT 193

  Fly   360 EVQVKIWFQNRRAKW-KRVKAGLTSHGLGRNGTTSGTKIVVPIPVHVNRFAVRSQHQQLEKMCLS 423
            |.:|::||||||||| ||.:.|....  |||..|:...|.| :|       ....|.||:....:
Human   194 EARVQVWFQNRRAKWRKRERYGKIQE--GRNPFTAAYDISV-LP-------RTDSHPQLQNSLWA 248

  Fly   424 GP---KPDLRKKLSAEAIGGFEKFSGSTNASSPSGGPVGLGVGVGVGVGVGLGVSTPLSLARSIY 485
            .|   .|.....:|.|.|        .:...||...|.|...|.       :||..|.:....||
Human   249 SPGSGSPGGPCLVSPEGI--------PSPCMSPYSHPHGSVAGF-------MGVPAPSAAHPGIY 298

  Fly   486  485
            Human   299  298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 24/51 (47%)
ALX3NP_006483.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..104 36/158 (23%)
PRK12323 <13..131 CDD:237057 42/195 (22%)
Homeobox 157..210 CDD:365835 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.