DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Pax6

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_006234695.1 Gene:Pax6 / 25509 RGDID:3258 Length:436 Species:Rattus norvegicus


Alignment Length:420 Identity:94/420 - (22%)
Similarity:154/420 - (36%) Gaps:101/420 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 PHPLDTRFLPFNPAAAGVAPTDLSYRRL-------AELMNQDYVHSLSVHARLQHMAAAGRMHE- 206
            |.|..||......|.:|..|.|:| |.|       .::::.:.|.:..|...|      ||.:| 
  Rat    20 PLPDSTRQKIVELAHSGARPCDIS-RILQTHADAKVQVLDSENVSNGCVSKIL------GRYYET 77

  Fly   207 DQANPGMAQLQEP--TPPQAHSSPAKSGSHSP-------MEPALDVGMDEDFECSGDSCSDI-SL 261
            ....|......:|  ..|:..|..|:.....|       .:..|..|:     |:.|:...: |:
  Rat    78 GSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGV-----CTNDNIPSVSSI 137

  Fly   262 TMSPRNY---------NGEMDK------------SRNGAYTNSDSEDCSDDEGAQSRHEGGGMGG 305
            ....||.         :|..||            :|.|.|..:........:|.| :.||.|...
  Rat   138 NRVLRNLASEKQQMGADGMYDKLRMLNGQTGSWGTRPGWYPGTSVPGQPTQDGCQ-QQEGQGENT 201

  Fly   306 KDSQGNGSSSNS---------KSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEV 361
            .....||..|:.         |.:|.||:||.||:..||:||....|..:..|.::|..:.|.|.
  Rat   202 NSISSNGEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEA 266

  Fly   362 QVKIWFQNRRAKWKRVKAGLTSHGLGRNGTTS--------GTKIVVPIP---VHVNRF------- 408
            ::::||.||||||:| :..|.:.....:.|.|        .|.:..|||   ..|:.|       
  Rat   267 RIQVWFSNRRAKWRR-EEKLRNQRRQASNTPSHIPISSSFSTSVYQPIPQPTTPVSSFTSGSMLG 330

  Fly   409 ----AVRSQHQQLEKM---------CLSGPKPDLRKKLS-----AEAIGG--FEKFSGSTNASSP 453
                |:.:.:..|..|         .:..|.|......|     :.::.|  ::.::.....:..
  Rat   331 RTDTALTNTYSALPPMPSFTMANNLPMQPPVPSQTSSYSCMLPTSPSVNGRSYDTYTPPHMQTHM 395

  Fly   454 SGGPVGLGVGVGVGVGVGLGVSTPLSLARS 483
            :..|:|.......|: :..|||.|:.:..|
  Rat   396 NSQPMGTSGTTSTGL-ISPGVSVPVQVPGS 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 21/50 (42%)
Pax6XP_006234695.1 PAX 4..142 CDD:128645 28/133 (21%)
Homeobox 228..281 CDD:395001 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.