DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Hoxc4

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001103354.1 Gene:Hoxc4 / 24459 RGDID:1586210 Length:264 Species:Rattus norvegicus


Alignment Length:281 Identity:75/281 - (26%)
Similarity:101/281 - (35%) Gaps:108/281 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 YLPS-SPAGHPAAQQPQAQAQPQ---PPPPHPPTHALEKQLPPTLPHPLDTRFLPFNPAAAGVAP 169
            |:|. ||..:...::...|...|   ||||..|::...:....:|..|.::|             
  Rat    28 YIPEHSPEYYGRTRESGFQHHHQELYPPPPPRPSYPERQYSCTSLQGPGNSR------------- 79

  Fly   170 TDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSH 234
                                 .|...|    ||..|.:::.|    |.||.|     ....|.|.
  Rat    80 ---------------------AHGPAQ----AGHHHPEKSQP----LCEPAP-----LSGASASP 110

  Fly   235 SPMEPALDVGMDEDFECSGDSCSDISL---------TMSPRNYNGEMDKSRNGAYTNSDSEDCSD 290
            ||..||..... .|...|..|...|..         |::| ||||                    
  Rat   111 SPAPPACSQPA-PDHPSSAASKQPIVYPWMKKIHVSTVNP-NYNG-------------------- 153

  Fly   291 DEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATS 355
                                      .:.:|.|||:|.:|:||||:|||..:||:...|.:||.|
  Rat   154 --------------------------GEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHS 192

  Fly   356 LKLSEVQVKIWFQNRRAKWKR 376
            |.|||.|:||||||||.|||:
  Rat   193 LCLSERQIKIWFQNRRMKWKK 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 31/50 (62%)
Hoxc4NP_001103354.1 Homeobox 159..213 CDD:395001 33/53 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.